PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.08G102200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 759aa    MW: 85036.2 Da    PI: 6.4133
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.08G102200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.79.1e-23128229199
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f+k+ltpsd++++g +++ +++a+e+      +++++  ++l+ +d+ g++W +++i+r++++r++l++GW+ Fv+a++L +gD ++F  
  Manes.08G102200.2.p 128 FCKTLTPSDTSTHGGFSVLRRHADEClppldmSLQPPA-QELVAKDLLGNKWHFRHIFRGQPRRHLLQSGWSLFVSAKKLVAGDAFIFL- 215
                          99*****************************9666665.59************************************************. PP

                          -SSSEE..EEEEE-S CS
                   B3  85 dgrsefelvvkvfrk 99 
                           + +++e +v+v+r+
  Manes.08G102200.2.p 216 -RGENGEIRVGVRRA 229
                          .4499999****996 PP

2Auxin_resp117.41.2e-38254336183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha+st+++F+v+Y+Pr+s++eF+++v+k+ +++k++++ GmRfkm+fe e+++e+rlsGtvvgv+++dp rWp SkWr+Lk
  Manes.08G102200.2.p 254 AWHAVSTGTMFTVYYKPRTSPAEFIIPVDKYDESVKSSFTTGMRFKMRFEAEEAPEQRLSGTVVGVEQADPKRWPASKWRCLK 336
                          89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.12E-38121257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.0E-39122243IPR015300DNA-binding pseudobarrel domain
CDDcd100176.39E-21126228No hitNo description
PROSITE profilePS5086311.533128230IPR003340B3 DNA binding domain
SMARTSM010191.2E-20128230IPR003340B3 DNA binding domain
PfamPF023621.2E-20128229IPR003340B3 DNA binding domain
PfamPF065078.4E-36254336IPR010525Auxin response factor
PfamPF023091.3E-10635727IPR033389AUX/IAA domain
PROSITE profilePS5174524.674636729IPR000270PB1 domain
SuperFamilySSF542773.34E-11637713No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MIIAGSSADN DCNGIAIADS GDALYRELWH ACAGPLVSVP RQGELVYYFP QGHIEQVQAS  60
TNQVADQQMP AYDLPAKILC RVVNVQLKAE LDTDEVFAQI TLLPQHEQDA KLVEEALPPP  120
TRPRVHSFCK TLTPSDTSTH GGFSVLRRHA DECLPPLDMS LQPPAQELVA KDLLGNKWHF  180
RHIFRGQPRR HLLQSGWSLF VSAKKLVAGD AFIFLRGENG EIRVGVRRAM RQPSNIPPSV  240
ISSHSMHIGI LATAWHAVST GTMFTVYYKP RTSPAEFIIP VDKYDESVKS SFTTGMRFKM  300
RFEAEEAPEQ RLSGTVVGVE QADPKRWPAS KWRCLKVRWD ETSPIHRPEK VSPWEIEPAS  360
APSLNSLPAC RIKRPRSNMA MHSADSAASI KKDNGLSRDL QDQENETLRS TFAVSKFQET  420
AQNPSRGSSL HVKDQNCTYF GKRRFEHESR NPQLGLGEKY LNAALGQQTP HDSGEFGQHL  480
VDLIPDTAGQ LKKHVVDEEN KLNWCSLSIM HSGPSLNMCE PILEPHTSKD KEICPTSWNL  540
KSTFLRQSDY VQGMEVDYQP GQRILSQGCA GNSPIATEKL HPLSLQLHEE DMGSNLSLQE  600
FKNPKCSESI IRCDEEKSFL ASDNFVLNKT QGGLTRRCVK VQKQGIGVGR SVDLTKFNNY  660
DEFLAELDQI FEFNGELVAP NKNWLVVFTD DEGDMMLVGD DPWQEFCSMV RRILIYTREE  720
INRMDPRSLN TIVEENSTVA DHIAVEDKSS KHLPTASV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-17273632359Auxin response factor 1
4ldw_A1e-17273632359Auxin response factor 1
4ldw_B1e-17273632359Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015570524.10.0PREDICTED: auxin response factor 2 isoform X2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9RFY90.0B9RFY9_RICCO; Auxin response factor
STRINGPOPTR_0003s16210.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2